Lineage for d1i6aa_ (1i6a A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Family c.94.1.1: Phosphate binding protein-like [53851] (17 proteins) 
Protein Hydrogen peroxide-inducible genes activator OxyR, regulatory domain [64193] (1 species) Species Escherichia coli [TaxId:562] [64194] (2 PDB entries) 
Domain d1i6aa_: 1i6a A: [61827]
Details for d1i6aa_
PDB Entry: 1i6a (more details), 2.3 Å
PDB Description: crystal structure of the oxidized form of oxyr
SCOP Domain Sequences for d1i6aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6aa_ c.94.1.1 (A:) Hydrogen peroxide-inducible genes activator OxyR, regulatory domain {Escherichia coli}
etmsgplhigliptvgpyllphiipmlhqtfpklemylheaqthqllaqldsgkldavil
alvkeseafievplfdepmllaiyedhpwanreavpmadlagekllmledghclrdqamg
fcfeagadedthfratsletlrnmvaagsgitllpalavpperkrdgvvylpaikpeprr
tiglvyrpgsplrsryeqlaeairarmdghfd
SCOP Domain Coordinates for d1i6aa_:
Click to download the PDB-style file with coordinates for d1i6aa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i6aa_:
- d1i6aa_ is new in SCOP 1.57
- d1i6aa_ appears in SCOP 1.59
- d1i6aa_ appears in the current release, SCOPe 2.08
View in 3D