Lineage for d1i69b_ (1i69 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1009059Protein Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain [64193] (1 species)
  7. 1009060Species Escherichia coli [TaxId:562] [64194] (2 PDB entries)
  8. 1009063Domain d1i69b_: 1i69 B: [61826]
    complexed with bez

Details for d1i69b_

PDB Entry: 1i69 (more details), 2.7 Å

PDB Description: crystal structure of the reduced form of oxyr
PDB Compounds: (B:) hydrogen peroxide-inducible genes activator

SCOPe Domain Sequences for d1i69b_:

Sequence, based on SEQRES records: (download)

>d1i69b_ c.94.1.1 (B:) Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain {Escherichia coli [TaxId: 562]}
etmsgplhigliptvgpyllphiipmlhqtfpklemylheaqthqllaqldsgkldavil
alvkeseafievplfdepmllaiyedhpwanreavpmadlagekllmledghslrdqamg
fcfeagadedthfratsletlrnmvaagsgitllpalavpperkrdgvvylpaikpeprr
tiglvyrpgsplrsryeqlaeairarmdghfd

Sequence, based on observed residues (ATOM records): (download)

>d1i69b_ c.94.1.1 (B:) Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain {Escherichia coli [TaxId: 562]}
etmsgplhigliptvgpyllphiipmlhqtfpklemylheaqthqllaqldsgkldavil
alvkeseafievplfdepmllaiyedhpwanreavpmadlagekllmledghslrdqamg
fcfethfratsletlrnmvaagsgitllpalavpperkrdgvvylpaikpeprrtiglvy
rpgsplrsryeqlaeairarmdghfd

SCOPe Domain Coordinates for d1i69b_:

Click to download the PDB-style file with coordinates for d1i69b_.
(The format of our PDB-style files is described here.)

Timeline for d1i69b_: