SCOP 1.75: Domain d1i69b_: 1i69 B:

Lineage for d1i69b_ (1i69 B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain [64193] (1 species)

7. Species Escherichia coli [TaxId:562] [64194] (2 PDB entries)

8. Domain d1i69b_: 1i69 B: [61826]
   complexed with box; mutant

Details for d1i69b_

PDB Entry: 1i69, 2.7 Å

PDB Description: crystal structure of the reduced form of oxyr

PDB Compounds: (B:) hydrogen peroxide-inducible genes activator

SCOP Domain Sequences for d1i69b_:

Sequence, based on SEQRES records:

>d1i69b_ c.94.1.1 (B:) Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain {Escherichia coli [TaxId: 562]}
etmsgplhigliptvgpyllphiipmlhqtfpklemylheaqthqllaqldsgkldavil
alvkeseafievplfdepmllaiyedhpwanreavpmadlagekllmledghslrdqamg
fcfeagadedthfratsletlrnmvaagsgitllpalavpperkrdgvvylpaikpeprr
tiglvyrpgsplrsryeqlaeairarmdghfd

Sequence, based on observed residues (ATOM records):

>d1i69b_ c.94.1.1 (B:) Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain {Escherichia coli [TaxId: 562]}
etmsgplhigliptvgpyllphiipmlhqtfpklemylheaqthqllaqldsgkldavil
alvkeseafievplfdepmllaiyedhpwanreavpmadlagekllmledghslrdqamg
fcfethfratsletlrnmvaagsgitllpalavpperkrdgvvylpaikpeprrtiglvy
rpgsplrsryeqlaeairarmdghfd

Timeline for d1i69b_:

• d1i69b_ first appeared in SCOP 1.57
  
• d1i69b_ appears in SCOP 1.73
  
• d1i69b_ appears in SCOPe 2.01
  
• d1i69b_ appears in the current release, SCOPe 2.08