Lineage for d1i5ua_ (1i5u A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579636Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2579637Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2579638Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. 2579639Protein Cytochrome b5 [55858] (4 species)
  7. 2579640Species Cow (Bos taurus) [TaxId:9913] [55859] (18 PDB entries)
    Uniprot P00171 7-88 ! Uniprot P00171 8-89
  8. 2579651Domain d1i5ua_: 1i5u A: [61824]
    complexed with hem; mutant

Details for d1i5ua_

PDB Entry: 1i5u (more details)

PDB Description: solution structure of cytochrome b5 triple mutant (e48a/e56a/d60a)
PDB Compounds: (A:) cytochrome b5

SCOPe Domain Sequences for d1i5ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5ua_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]}
avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlraqaggdatanfeavg
hstdarelsktfiigelhpddr

SCOPe Domain Coordinates for d1i5ua_:

Click to download the PDB-style file with coordinates for d1i5ua_.
(The format of our PDB-style files is described here.)

Timeline for d1i5ua_: