Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) |
Family d.120.1.1: Cytochrome b5 [55857] (5 proteins) |
Protein Cytochrome b5 [55858] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [55859] (18 PDB entries) Uniprot P00171 7-88 ! Uniprot P00171 8-89 |
Domain d1i5ua_: 1i5u A: [61824] complexed with hem; mutant |
PDB Entry: 1i5u (more details)
SCOPe Domain Sequences for d1i5ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i5ua_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlraqaggdatanfeavg hstdarelsktfiigelhpddr
Timeline for d1i5ua_: