Lineage for d1i5pa3 (1i5p A:1-263)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021084Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) (S)
    automatically mapped to Pfam PF03945
  5. 3021085Family f.1.3.1: delta-Endotoxin (insectocide), N-terminal domain [56850] (2 proteins)
    seven-helical bundle with central helix surrounded by six others
  6. 3021086Protein delta-Endotoxin (insectocide), N-terminal domain [56851] (5 species)
  7. 3021087Species Bacillus thuringiensis subsp. kurstaki, CRY2AA [TaxId:29339] [64523] (1 PDB entry)
  8. 3021088Domain d1i5pa3: 1i5p A:1-263 [61819]
    Other proteins in same PDB: d1i5pa1, d1i5pa2

Details for d1i5pa3

PDB Entry: 1i5p (more details), 2.2 Å

PDB Description: insecticidal crystal protein cry2aa
PDB Compounds: (A:) pesticidial crystal protein cry2aa

SCOPe Domain Sequences for d1i5pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5pa3 f.1.3.1 (A:1-263) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis subsp. kurstaki, CRY2AA [TaxId: 29339]}
mnnvlnsgrtticdaynvvahdpfsfehksldtiqkewmewkrtdhslyvapvvgtvssf
llkkvgsligkrilselwgiifpsgstnlmqdilreteqflnqrlntdtlarvnaeligl
qanirefnqqvdnflnptqnpvplsitssvntmqqlflnrlpqfqiqgyqllllplfaqa
anmhlsfirdvilnadewgisaatlrtyrdylrnytrdysnycintyqtafrglntrlhd
mlefrtymflnvfeyvsiwslfk

SCOPe Domain Coordinates for d1i5pa3:

Click to download the PDB-style file with coordinates for d1i5pa3.
(The format of our PDB-style files is described here.)

Timeline for d1i5pa3: