Lineage for d1i5pa2 (1i5p A:264-472)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.77: beta-Prism I [51091] (3 superfamilies) 
Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (1 family) 
Family b.77.2.1: delta-Endotoxin (insectocide), middle domain [51097] (1 protein) Protein delta-Endotoxin (insectocide), middle domain [51098] (4 species) 
Species Bacillus thuringiensis subsp. kurstaki, CRY2AA [TaxId:29339] [63846] (1 PDB entry) 
Domain d1i5pa2: 1i5p A:264-472 [61818]
Other proteins in same PDB: d1i5pa1, d1i5pa3
Details for d1i5pa2
PDB Entry: 1i5p (more details), 2.2 Å
PDB Description: insecticidal crystal protein cry2aa
SCOP Domain Sequences for d1i5pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i5pa2 b.77.2.1 (A:264-472) delta-Endotoxin (insectocide), middle domain {Bacillus thuringiensis subsp. kurstaki, CRY2AA}
yqslmvssganlyasgsgpqqtqsftaqnwpflyslfqvnsnyilsgisgtrlsitfpni
gglpgsttthslnsarvnysggvssgligatnlnhnfncstvlpplstpfvrswldsgtd
ragvatstnwqtesfqttlslrcgafsargnsnyfpdyfirnisgvplvirnedltrplh
ynqirniespsgtpggaraylvsvhnrkn
SCOP Domain Coordinates for d1i5pa2:
Click to download the PDB-style file with coordinates for d1i5pa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i5pa2:
- d1i5pa2 is new in SCOP 1.57
- d1i5pa2 appears in SCOP 1.59
- d1i5pa2 appears in the current release, SCOPe 2.08
View in 3D
