Lineage for d1i5pa1 (1i5p A:473-633)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774180Family b.18.1.3: delta-Endotoxin, C-terminal domain [49796] (1 protein)
    automatically mapped to Pfam PF03944
  6. 2774181Protein delta-Endotoxin, C-terminal domain [49797] (5 species)
  7. 2774182Species Bacillus thuringiensis subsp. kurstaki, CRY2AA [TaxId:29339] [63717] (1 PDB entry)
  8. 2774183Domain d1i5pa1: 1i5p A:473-633 [61817]
    Other proteins in same PDB: d1i5pa2, d1i5pa3

Details for d1i5pa1

PDB Entry: 1i5p (more details), 2.2 Å

PDB Description: insecticidal crystal protein cry2aa
PDB Compounds: (A:) pesticidial crystal protein cry2aa

SCOPe Domain Sequences for d1i5pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5pa1 b.18.1.3 (A:473-633) delta-Endotoxin, C-terminal domain {Bacillus thuringiensis subsp. kurstaki, CRY2AA [TaxId: 29339]}
niyaanengtmihlapedytgftispihatqvnnqtrtfisekfgnqgdslrfeqsntta
rytlrgngnsynlylrvssignstirvtingrvytvsnvntttnndgvndngarfsdini
gnivasdntnvtldinvtlnsgtpfdlmnimfvptnlpply

SCOPe Domain Coordinates for d1i5pa1:

Click to download the PDB-style file with coordinates for d1i5pa1.
(The format of our PDB-style files is described here.)

Timeline for d1i5pa1: