Lineage for d1i5ob1 (1i5o B:1-100)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412028Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 412029Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 412030Protein Aspartate carbamoyltransferase [54895] (1 species)
  7. 412031Species Escherichia coli [TaxId:562] [54896] (27 PDB entries)
  8. 412062Domain d1i5ob1: 1i5o B:1-100 [61811]
    Other proteins in same PDB: d1i5oa1, d1i5oa2, d1i5ob2, d1i5oc1, d1i5oc2, d1i5od2

Details for d1i5ob1

PDB Entry: 1i5o (more details), 2.8 Å

PDB Description: crystal structure of mutant r105a of e. coli aspartate transcarbamoylase

SCOP Domain Sequences for d1i5ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5ob1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1i5ob1:

Click to download the PDB-style file with coordinates for d1i5ob1.
(The format of our PDB-style files is described here.)

Timeline for d1i5ob1: