Lineage for d1i5nd_ (1i5n D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765604Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (6 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 765643Family a.24.10.3: Chemotaxis protein CheA P1 domain [63512] (1 protein)
  6. 765644Protein Chemotaxis protein CheA P1 domain [63513] (2 species)
  7. 765645Species Salmonella typhimurium [TaxId:90371] [63514] (1 PDB entry)
  8. 765649Domain d1i5nd_: 1i5n D: [61808]
    complexed with so4

Details for d1i5nd_

PDB Entry: 1i5n (more details), 2.14 Å

PDB Description: Crystal structure of the P1 domain of CheA from Salmonella typhimurium
PDB Compounds: (D:) chemotaxis protein chea

SCOP Domain Sequences for d1i5nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5nd_ a.24.10.3 (D:) Chemotaxis protein CheA P1 domain {Salmonella typhimurium [TaxId: 90371]}
isdfyqtffdeadelladmeqhlldlvpespdaeqlnaifraahsikggagtfgftilqe
tthlmenlldearrgemqlntdiinlfletkdimqeqldayknseepdaasfeyicnalr
qlaleakge

SCOP Domain Coordinates for d1i5nd_:

Click to download the PDB-style file with coordinates for d1i5nd_.
(The format of our PDB-style files is described here.)

Timeline for d1i5nd_: