Lineage for d1i5nd_ (1i5n D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700189Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 2700231Family a.24.10.3: Chemotaxis protein CheA P1 domain [63512] (1 protein)
  6. 2700232Protein Chemotaxis protein CheA P1 domain [63513] (2 species)
  7. 2700233Species Salmonella typhimurium [TaxId:90371] [63514] (1 PDB entry)
  8. 2700237Domain d1i5nd_: 1i5n D: [61808]
    complexed with so4

Details for d1i5nd_

PDB Entry: 1i5n (more details), 2.14 Å

PDB Description: Crystal structure of the P1 domain of CheA from Salmonella typhimurium
PDB Compounds: (D:) chemotaxis protein chea

SCOPe Domain Sequences for d1i5nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5nd_ a.24.10.3 (D:) Chemotaxis protein CheA P1 domain {Salmonella typhimurium [TaxId: 90371]}
isdfyqtffdeadelladmeqhlldlvpespdaeqlnaifraahsikggagtfgftilqe
tthlmenlldearrgemqlntdiinlfletkdimqeqldayknseepdaasfeyicnalr
qlaleakge

SCOPe Domain Coordinates for d1i5nd_:

Click to download the PDB-style file with coordinates for d1i5nd_.
(The format of our PDB-style files is described here.)

Timeline for d1i5nd_: