Lineage for d1i5na_ (1i5n A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313536Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 2313578Family a.24.10.3: Chemotaxis protein CheA P1 domain [63512] (1 protein)
  6. 2313579Protein Chemotaxis protein CheA P1 domain [63513] (2 species)
  7. 2313580Species Salmonella typhimurium [TaxId:90371] [63514] (1 PDB entry)
  8. 2313581Domain d1i5na_: 1i5n A: [61805]
    complexed with so4

Details for d1i5na_

PDB Entry: 1i5n (more details), 2.14 Å

PDB Description: Crystal structure of the P1 domain of CheA from Salmonella typhimurium
PDB Compounds: (A:) chemotaxis protein chea

SCOPe Domain Sequences for d1i5na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5na_ a.24.10.3 (A:) Chemotaxis protein CheA P1 domain {Salmonella typhimurium [TaxId: 90371]}
disdfyqtffdeadelladmeqhlldlvpespdaeqlnaifraahsikggagtfgftilq
etthlmenlldearrgemqlntdiinlfletkdimqeqldayknseepdaasfeyicnal
rqlaleak

SCOPe Domain Coordinates for d1i5na_:

Click to download the PDB-style file with coordinates for d1i5na_.
(The format of our PDB-style files is described here.)

Timeline for d1i5na_: