SCOPe 2.01: Domain d1i5na_: 1i5n A:

Lineage for d1i5na_ (1i5n A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (6 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.3: Chemotaxis protein CheA P1 domain [63512] (1 protein)

6. Protein Chemotaxis protein CheA P1 domain [63513] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [63514] (1 PDB entry)

8. Domain d1i5na_: 1i5n A: [61805]
   complexed with so4

Details for d1i5na_

PDB Entry: 1i5n, 2.14 Å

PDB Description: Crystal structure of the P1 domain of CheA from Salmonella typhimurium

PDB Compounds: (A:) chemotaxis protein chea

SCOPe Domain Sequences for d1i5na_:

Sequence; same for both SEQRES and ATOM records:

>d1i5na_ a.24.10.3 (A:) Chemotaxis protein CheA P1 domain {Salmonella typhimurium [TaxId: 90371]}
disdfyqtffdeadelladmeqhlldlvpespdaeqlnaifraahsikggagtfgftilq
etthlmenlldearrgemqlntdiinlfletkdimqeqldayknseepdaasfeyicnal
rqlaleak

Timeline for d1i5na_:

• d1i5na_ first appeared in SCOP 1.57
  
• d1i5na_ appears in SCOP 1.75
  
• d1i5na_ appears in SCOPe 2.02
  
• d1i5na_ appears in the current release, SCOPe 2.08