Lineage for d1i5na_ (1i5n A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96219Fold a.24: Four-helical up-and-down bundle [47161] (14 superfamilies)
  4. 96387Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (3 families) (S)
  5. 96406Family a.24.10.3: Chemotaxis protein CheA P1 domain [63512] (1 protein)
  6. 96407Protein Chemotaxis protein CheA P1 domain [63513] (1 species)
  7. 96408Species Salmonella typhimurium [TaxId:90371] [63514] (1 PDB entry)
  8. 96409Domain d1i5na_: 1i5n A: [61805]

Details for d1i5na_

PDB Entry: 1i5n (more details), 2.14 Å

PDB Description: Crystal structure of the P1 domain of CheA from Salmonella typhimurium

SCOP Domain Sequences for d1i5na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5na_ a.24.10.3 (A:) Chemotaxis protein CheA P1 domain {Salmonella typhimurium}
disdfyqtffdeadelladmeqhlldlvpespdaeqlnaifraahsikggagtfgftilq
etthlmenlldearrgemqlntdiinlfletkdimqeqldayknseepdaasfeyicnal
rqlaleak

SCOP Domain Coordinates for d1i5na_:

Click to download the PDB-style file with coordinates for d1i5na_.
(The format of our PDB-style files is described here.)

Timeline for d1i5na_: