Lineage for d1i5lj_ (1i5l J:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2396392Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2396393Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 2396394Species Archaeoglobus fulgidus, AF-Sm1 [TaxId:2234] [63761] (2 PDB entries)
  8. 2396432Domain d1i5lj_: 1i5l J: [61800]
    complexed with short poly-U RNA
    protein/RNA complex; complexed with uri

Details for d1i5lj_

PDB Entry: 1i5l (more details), 2.75 Å

PDB Description: crystal structure of an sm-like protein (af-sm1) from archaeoglobus fulgidus complexed with short poly-u rna
PDB Compounds: (J:) putative snrnp sm-like protein af-sm1

SCOPe Domain Sequences for d1i5lj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5lj_ b.38.1.1 (J:) Archaeal homoheptameric Sm protein {Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]}
prpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvvi
rgdtvvfvspap

SCOPe Domain Coordinates for d1i5lj_:

Click to download the PDB-style file with coordinates for d1i5lj_.
(The format of our PDB-style files is described here.)

Timeline for d1i5lj_: