| Class b: All beta proteins [48724] (176 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins) forms homo and heteroheptameric ring structures |
| Protein Archaeal homoheptameric Sm protein [63758] (6 species) |
| Species Archaeoglobus fulgidus, AF-Sm1 [TaxId:2234] [63761] (2 PDB entries) |
| Domain d1i5le_: 1i5l E: [61795] complexed with short poly-U RNA protein/RNA complex; complexed with uri |
PDB Entry: 1i5l (more details), 2.75 Å
SCOPe Domain Sequences for d1i5le_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i5le_ b.38.1.1 (E:) Archaeal homoheptameric Sm protein {Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]}
prpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvvi
rgdtvvfvspa
Timeline for d1i5le_: