Lineage for d1i5lc_ (1i5l C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057136Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2057137Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2057138Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 2057139Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 2057140Species Archaeoglobus fulgidus, AF-Sm1 [TaxId:2234] [63761] (2 PDB entries)
  8. 2057171Domain d1i5lc_: 1i5l C: [61793]
    complexed with short poly-U RNA
    protein/RNA complex; complexed with uri

Details for d1i5lc_

PDB Entry: 1i5l (more details), 2.75 Å

PDB Description: crystal structure of an sm-like protein (af-sm1) from archaeoglobus fulgidus complexed with short poly-u rna
PDB Compounds: (C:) putative snrnp sm-like protein af-sm1

SCOPe Domain Sequences for d1i5lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5lc_ b.38.1.1 (C:) Archaeal homoheptameric Sm protein {Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]}
mpprpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsv
virgdtvvfvspap

SCOPe Domain Coordinates for d1i5lc_:

Click to download the PDB-style file with coordinates for d1i5lc_.
(The format of our PDB-style files is described here.)

Timeline for d1i5lc_: