Lineage for d1i5lb_ (1i5l B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798178Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 798179Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (6 families) (S)
  5. 798180Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 798181Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 798182Species Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId:2234] [63761] (2 PDB entries)
  8. 798212Domain d1i5lb_: 1i5l B: [61792]
    complexed with short poly-U RNA

Details for d1i5lb_

PDB Entry: 1i5l (more details), 2.75 Å

PDB Description: crystal structure of an sm-like protein (af-sm1) from archaeoglobus fulgidus complexed with short poly-u rna
PDB Compounds: (B:) putative snrnp sm-like protein af-sm1

SCOP Domain Sequences for d1i5lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5lb_ b.38.1.1 (B:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]}
prpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvvi
rgdtvvfvspapg

SCOP Domain Coordinates for d1i5lb_:

Click to download the PDB-style file with coordinates for d1i5lb_.
(The format of our PDB-style files is described here.)

Timeline for d1i5lb_: