Lineage for d1i5la_ (1i5l A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58846Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily)
  4. 58847Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) (S)
  5. 58848Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins)
  6. 58849Protein Archaeal homoheptameric Sm protein [63758] (3 species)
  7. 58850Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [63761] (2 PDB entries)
  8. 58879Domain d1i5la_: 1i5l A: [61791]

Details for d1i5la_

PDB Entry: 1i5l (more details), 2.75 Å

PDB Description: crystal structure of an sm-like protein (af-sm1) from archaeoglobus fulgidus complexed with short poly-u rna

SCOP Domain Sequences for d1i5la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5la_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus}
prpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvvi
rgdtvvfvspa

SCOP Domain Coordinates for d1i5la_:

Click to download the PDB-style file with coordinates for d1i5la_.
(The format of our PDB-style files is described here.)

Timeline for d1i5la_: