Lineage for d1i5kb1 (1i5k B:100-178)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260117Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2260118Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2260119Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 2260184Protein Plasminogen [63400] (1 species)
  7. 2260185Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries)
  8. 2260210Domain d1i5kb1: 1i5k B:100-178 [61790]
    Other proteins in same PDB: d1i5kb2
    kringle 2; complexed to an internal peptide from a group A streptococcal surface protein

Details for d1i5kb1

PDB Entry: 1i5k (more details), 2.7 Å

PDB Description: structure and binding determinants of the recombinant kringle-2 domain of human plasminogen to an internal peptide from a group a streptococcal surface protein
PDB Compounds: (B:) plasminogen

SCOPe Domain Sequences for d1i5kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5kb1 g.14.1.1 (B:100-178) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
ecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrdlrp
wcfttdpnkrweycdiprc

SCOPe Domain Coordinates for d1i5kb1:

Click to download the PDB-style file with coordinates for d1i5kb1.
(The format of our PDB-style files is described here.)

Timeline for d1i5kb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i5kb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1i5ka_