SCOP 1.71: Domain d1i5ka_: 1i5k A:

Lineage for d1i5ka_ (1i5k A:)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (6 proteins)

6. Protein Plasminogen [63400] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63401] (16 PDB entries)

8. Domain d1i5ka_: 1i5k A: [61789]

Details for d1i5ka_

PDB Entry: 1i5k, 2.7 Å

PDB Description: structure and binding determinants of the recombinant kringle-2 domain of human plasminogen to an internal peptide from a group a streptococcal surface protein

SCOP Domain Sequences for d1i5ka_:

Sequence; same for both SEQRES and ATOM records:

>d1i5ka_ g.14.1.1 (A:) Plasminogen {Human (Homo sapiens)}
ecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrdlrp
wcfttdpnkrweycdiprc

Timeline for d1i5ka_:

• d1i5ka_ first appeared in SCOP 1.57
  
• d1i5ka_ appears in SCOP 1.69
  
• d1i5ka_ appears in SCOP 1.73
  
• d1i5ka_ appears in the current release, SCOPe 2.08