Lineage for d1i5ka_ (1i5k A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623175Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 623176Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 623177Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 623214Protein Plasminogen [63400] (1 species)
  7. 623215Species Human (Homo sapiens) [TaxId:9606] [63401] (16 PDB entries)
  8. 623237Domain d1i5ka_: 1i5k A: [61789]

Details for d1i5ka_

PDB Entry: 1i5k (more details), 2.7 Å

PDB Description: structure and binding determinants of the recombinant kringle-2 domain of human plasminogen to an internal peptide from a group a streptococcal surface protein

SCOP Domain Sequences for d1i5ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5ka_ g.14.1.1 (A:) Plasminogen {Human (Homo sapiens)}
ecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrdlrp
wcfttdpnkrweycdiprc

SCOP Domain Coordinates for d1i5ka_:

Click to download the PDB-style file with coordinates for d1i5ka_.
(The format of our PDB-style files is described here.)

Timeline for d1i5ka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i5kb_