Lineage for d1i5cb_ (1i5c B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973838Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 2973851Protein Histidine kinase CheA [55887] (2 species)
  7. 2973852Species Thermotoga maritima [TaxId:2336] [55888] (8 PDB entries)
  8. 2973858Domain d1i5cb_: 1i5c B: [61782]
    ATP-binding domain (p4) only
    complexed with adp

Details for d1i5cb_

PDB Entry: 1i5c (more details), 1.9 Å

PDB Description: structure of chea domain p4 in complex with adp
PDB Compounds: (B:) chemotaxis protein chea

SCOPe Domain Sequences for d1i5cb_:

Sequence, based on SEQRES records: (download)

>d1i5cb_ d.122.1.3 (B:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]}
hmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaidh
giepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglidesk
aatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgtkv
tirlplt

Sequence, based on observed residues (ATOM records): (download)

>d1i5cb_ d.122.1.3 (B:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]}
hmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaidh
giepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglidesk
aatlsdqeilnflfvpgfstkgvgmdvvknvveslngsisiesekdkgtkvtirlplt

SCOPe Domain Coordinates for d1i5cb_:

Click to download the PDB-style file with coordinates for d1i5cb_.
(The format of our PDB-style files is described here.)

Timeline for d1i5cb_: