Lineage for d1i5ab_ (1i5a B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83597Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
  4. 83598Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (3 families) (S)
  5. 83626Family d.122.1.3: Histidine kinase [55884] (2 proteins)
  6. 83627Protein Histidine kinase CheA [55887] (1 species)
  7. 83628Species Thermotoga maritima [TaxId:243274] [55888] (7 PDB entries)
  8. 83634Domain d1i5ab_: 1i5a B: [61778]

Details for d1i5ab_

PDB Entry: 1i5a (more details), 1.9 Å

PDB Description: structure of chea domain p4 in complex with adpcp and manganese

SCOP Domain Sequences for d1i5ab_:

Sequence, based on SEQRES records: (download)

>d1i5ab_ d.122.1.3 (B:) Histidine kinase CheA {Thermotoga maritima}
shmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
kaatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgtk
vtirlplt

Sequence, based on observed residues (ATOM records): (download)

>d1i5ab_ d.122.1.3 (B:) Histidine kinase CheA {Thermotoga maritima}
shmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
kaatlsdqeilnflfvpgfstvgmdvvknvveslngsisiesekdkgtkvtirlplt

SCOP Domain Coordinates for d1i5ab_:

Click to download the PDB-style file with coordinates for d1i5ab_.
(The format of our PDB-style files is described here.)

Timeline for d1i5ab_: