SCOP 1.75: Domain d1i55b_: 1i55 B:

Lineage for d1i55b_ (1i55 B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [46646] (5 PDB entries)
   identical sequence to Thunnus alalunga, TaxId: 8235

8. Domain d1i55b_: 1i55 B: [61771]
   complexed with hem, znh

Details for d1i55b_

PDB Entry: 1i55, 2 Å

PDB Description: cytochrome c (tuna) with 2zn:1fe mixed-metal porphyrins

PDB Compounds: (B:) cytochrome c

SCOP Domain Sequences for d1i55b_:

Sequence; same for both SEQRES and ATOM records:

>d1i55b_ a.3.1.1 (B:) Mitochondrial cytochrome c {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

Timeline for d1i55b_:

• d1i55b_ first appeared in SCOP 1.57
  
• d1i55b_ appears in SCOP 1.73
  
• d1i55b_ appears in SCOPe 2.01
  
• d1i55b_ appears in the current release, SCOPe 2.08