Lineage for d1i55a_ (1i55 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437666Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 437667Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 437668Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 437826Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 437890Species Tuna (Thunnus alalunga and Thunnus thynnus) [46646] (5 PDB entries)
  8. 437896Domain d1i55a_: 1i55 A: [61770]

Details for d1i55a_

PDB Entry: 1i55 (more details), 2 Å

PDB Description: cytochrome c (tuna) with 2zn:1fe mixed-metal porphyrins

SCOP Domain Sequences for d1i55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i55a_ a.3.1.1 (A:) Mitochondrial cytochrome c {Tuna (Thunnus alalunga and Thunnus thynnus)}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

SCOP Domain Coordinates for d1i55a_:

Click to download the PDB-style file with coordinates for d1i55a_.
(The format of our PDB-style files is described here.)

Timeline for d1i55a_: