Lineage for d1i55a_ (1i55 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45125Protein Mitochondrial cytochrome c [46642] (5 species)
  7. 45176Species Tuna (Thunnus alalunga and Thunnus thynnus) [46646] (4 PDB entries)
  8. 45180Domain d1i55a_: 1i55 A: [61770]

Details for d1i55a_

PDB Entry: 1i55 (more details), 2 Å

PDB Description: cytochrome c (tuna) with 2zn:1fe mixed-metal porphyrins
PDB Compounds: (A:)

SCOP Domain Sequences for d1i55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i55a_ a.3.1.1 (A:) Mitochondrial cytochrome c {Tuna (Thunnus alalunga and Thunnus thynnus)}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

SCOP Domain Coordinates for d1i55a_:

Click to download the PDB-style file with coordinates for d1i55a_.
(The format of our PDB-style files is described here.)

Timeline for d1i55a_: