Lineage for d1i54a_ (1i54 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1719638Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1719846Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 1719920Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [46646] (5 PDB entries)
    identical sequence to Thunnus alalunga, TaxId: 8235
  8. 1719924Domain d1i54a_: 1i54 A: [61768]
    complexed with hem, znh

Details for d1i54a_

PDB Entry: 1i54 (more details), 1.5 Å

PDB Description: cytochrome c (tuna) 2fe:1zn mixed-metal porphyrins
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d1i54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i54a_ a.3.1.1 (A:) Mitochondrial cytochrome c {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

SCOPe Domain Coordinates for d1i54a_:

Click to download the PDB-style file with coordinates for d1i54a_.
(The format of our PDB-style files is described here.)

Timeline for d1i54a_: