Lineage for d1i52a_ (1i52 A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (12 families) 
Family c.68.1.11: 4-diphosphocytidyl-2-c-methylerythritol (CDP-me) synthase (YgbP) [64139] (1 protein) Protein 4-diphosphocytidyl-2-c-methylerythritol (CDP-me) synthase (YgbP) [64140] (1 species) Species Escherichia coli [TaxId:562] [64141] (2 PDB entries) 
Domain d1i52a_: 1i52 A: [61767]
Details for d1i52a_
PDB Entry: 1i52 (more details), 1.5 Å
PDB Description: crystal structure of 4-diphosphocytidyl-2-c-methylerythritol (cdp-me) synthase (ygbp) involved in mevalonate independent isoprenoid biosynthesis
SCOP Domain Sequences for d1i52a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i52a_ c.68.1.11 (A:) 4-diphosphocytidyl-2-c-methylerythritol (CDP-me) synthase (YgbP) {Escherichia coli}
hldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaispgdsr
faqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllals
etsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralne
gatitdeasaleycgfhpqlvegradnikvtrpedlalaefyltr
SCOP Domain Coordinates for d1i52a_:
Click to download the PDB-style file with coordinates for d1i52a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i52a_:
- d1i52a_ is new in SCOP 1.57
- d1i52a_ appears in SCOP 1.59
- d1i52a_ appears in the current release, SCOPe 2.08
View in 3D