Lineage for d1i52a_ (1i52 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898986Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 2898987Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (4 species)
  7. 2898988Species Escherichia coli [TaxId:562] [64141] (6 PDB entries)
  8. 2898990Domain d1i52a_: 1i52 A: [61767]
    complexed with ca, ctp, mg

Details for d1i52a_

PDB Entry: 1i52 (more details), 1.5 Å

PDB Description: crystal structure of 4-diphosphocytidyl-2-c-methylerythritol (cdp-me) synthase (ygbp) involved in mevalonate independent isoprenoid biosynthesis
PDB Compounds: (A:) 4-diphosphocytidyl-2-c-methylerythritol synthase

SCOPe Domain Sequences for d1i52a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]}
hldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaispgdsr
faqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllals
etsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralne
gatitdeasaleycgfhpqlvegradnikvtrpedlalaefyltr

SCOPe Domain Coordinates for d1i52a_:

Click to download the PDB-style file with coordinates for d1i52a_.
(The format of our PDB-style files is described here.)

Timeline for d1i52a_: