![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.13: Cytidylytransferase [68901] (7 proteins) |
![]() | Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [64141] (6 PDB entries) |
![]() | Domain d1i52a_: 1i52 A: [61767] complexed with ca, ctp, mg |
PDB Entry: 1i52 (more details), 1.5 Å
SCOPe Domain Sequences for d1i52a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} hldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaispgdsr faqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllals etsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralne gatitdeasaleycgfhpqlvegradnikvtrpedlalaefyltr
Timeline for d1i52a_: