Lineage for d1i50j_ (1i50 J:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 534099Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
  5. 534100Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein)
    Zn-binding site is near the N-terminus
  6. 534101Protein RNA polymerase subunit RPB10 [46926] (2 species)
  7. 534104Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (9 PDB entries)
  8. 534106Domain d1i50j_: 1i50 J: [61764]
    Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50c2, d1i50e1, d1i50e2, d1i50f_, d1i50h_, d1i50i1, d1i50i2, d1i50k_, d1i50l_
    complexed with mn, zn

Details for d1i50j_

PDB Entry: 1i50 (more details), 2.8 Å

PDB Description: rna polymerase ii crystal form ii at 2.8 a resolution
PDB Compounds: (J:)

SCOP Domain Sequences for d1i50j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i50j_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae)}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOP Domain Coordinates for d1i50j_:

Click to download the PDB-style file with coordinates for d1i50j_.
(The format of our PDB-style files is described here.)

Timeline for d1i50j_: