Lineage for d1i50h_ (1i50 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790275Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
    automatically mapped to Pfam PF03870
  6. 2790276Protein RNA polymerase subunit RBP8 [50322] (2 species)
  7. 2790277Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (36 PDB entries)
    Uniprot P20436
  8. 2790287Domain d1i50h_: 1i50 H: [61761]
    Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50c2, d1i50e1, d1i50e2, d1i50f_, d1i50i1, d1i50i2, d1i50j_, d1i50k_, d1i50l_
    protein/RNA complex; complexed with mn, zn

Details for d1i50h_

PDB Entry: 1i50 (more details), 2.8 Å

PDB Description: rna polymerase ii crystal form ii at 2.8 a resolution
PDB Compounds: (H:) DNA-directed RNA polymerase II 14.5kd polypeptide

SCOPe Domain Sequences for d1i50h_:

Sequence, based on SEQRES records: (download)

>d1i50h_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d1i50h_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr

SCOPe Domain Coordinates for d1i50h_:

Click to download the PDB-style file with coordinates for d1i50h_.
(The format of our PDB-style files is described here.)

Timeline for d1i50h_: