Lineage for d1i50f_ (1i50 F:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134790Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
  4. 134791Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
  5. 134805Family d.78.1.2: RPB6 [55294] (1 protein)
  6. 134806Protein RPB6 [55295] (2 species)
  7. 134807Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (4 PDB entries)
  8. 134808Domain d1i50f_: 1i50 F: [61760]
    Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50c2, d1i50e1, d1i50e2, d1i50h_, d1i50i1, d1i50i2, d1i50j_, d1i50k_, d1i50l_

Details for d1i50f_

PDB Entry: 1i50 (more details), 2.8 Å

PDB Description: rna polymerase ii crystal form ii at 2.8 a resolution
PDB Compounds: (F:)

SCOP Domain Sequences for d1i50f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i50f_ d.78.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae)}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOP Domain Coordinates for d1i50f_:

Click to download the PDB-style file with coordinates for d1i50f_.
(The format of our PDB-style files is described here.)

Timeline for d1i50f_: