Lineage for d1i50c2 (1i50 C:42-172)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 86058Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
  4. 86059Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 86060Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 86070Protein RPB3 [64462] (1 species)
  7. 86071Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (3 PDB entries)
  8. 86072Domain d1i50c2: 1i50 C:42-172 [61757]
    Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50e1, d1i50e2, d1i50f_, d1i50h_, d1i50i1, d1i50i2, d1i50j_, d1i50k_, d1i50l_

Details for d1i50c2

PDB Entry: 1i50 (more details), 2.8 Å

PDB Description: rna polymerase ii crystal form ii at 2.8 a resolution

SCOP Domain Sequences for d1i50c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i50c2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae)}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

SCOP Domain Coordinates for d1i50c2:

Click to download the PDB-style file with coordinates for d1i50c2.
(The format of our PDB-style files is described here.)

Timeline for d1i50c2: