Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) automatically mapped to Pfam PF01000 |
Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins) |
Protein RPB3 [64462] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries) Uniprot P16370; part of multichain biological unit |
Domain d1i50c2: 1i50 C:42-172 [61757] Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50e1, d1i50e2, d1i50f_, d1i50h_, d1i50i1, d1i50i2, d1i50j_, d1i50k_, d1i50l_ protein/RNA complex; complexed with mn, zn |
PDB Entry: 1i50 (more details), 2.8 Å
SCOPe Domain Sequences for d1i50c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i50c2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk giakehakwgp
Timeline for d1i50c2: