Lineage for d1i50b_ (1i50 B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249905Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2249906Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2249907Family e.29.1.1: RNA-polymerase beta [64485] (3 proteins)
  6. 2249908Protein RBP2 [64491] (2 species)
  7. 2249909Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64492] (27 PDB entries)
    Uniprot P08518; part of multichain biological unit
  8. 2249911Domain d1i50b_: 1i50 B: [61755]
    Other proteins in same PDB: d1i50a_, d1i50c1, d1i50c2, d1i50e1, d1i50e2, d1i50f_, d1i50h_, d1i50i1, d1i50i2, d1i50j_, d1i50k_, d1i50l_
    protein/RNA complex; complexed with mn, zn

Details for d1i50b_

PDB Entry: 1i50 (more details), 2.8 Å

PDB Description: rna polymerase ii crystal form ii at 2.8 a resolution
PDB Compounds: (B:) DNA-directed RNA polymerase II 140kd polypeptide

SCOPe Domain Sequences for d1i50b_:

Sequence, based on SEQRES records: (download)

>d1i50b_ e.29.1.1 (B:) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fedesapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqh
ttesdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrty
eaidvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpf
dmggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvk
lygregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpc
vedgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkaff
lgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtve
eahdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrr
tntpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitf
lsewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmir
direkelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedve
eytwssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhatt
fthceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanily
ypqkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffr
symdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttp
ispdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqig
dkfasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaal
sgnegdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrh
mvddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasda
frvhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprly
tdrsrdf

Sequence, based on observed residues (ATOM records): (download)

>d1i50b_ e.29.1.1 (B:) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fedesapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlieisfgki
yvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyekvfigrlpimlrskncy
lseatesdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaei
rsalekgsrfistlqvklygregssartikatlpyikqdipiviifralgiipdgeileh
icydvndwqmlemlkpcvedgfviqdretaldfigrrgtalgikkekriqyakdilqkef
lphitqlegfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktl
fkkltkdifrymqrtvelainaktitsglkyalatgnwgagvsqvlnrytysstlshlrr
tntpiakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgm
epledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdireke
lkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglvey
idaeeeesiliamqpedlepdvdpakrirvshhattfthceihpsmilgvaasiipfpdh
nqsprntyqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelpagq
naivaiacysgynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekpqrtn
tlrmkhgtydkldddgliapgvrvsgedviigkttpisskrdastplrstengivdqvlv
ttnqdglkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdliinp
haipsrmtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfevmyn
ghtgkklmaqiffgptyyqrlrhmvddkiharargpglrfgemerdcmiahgaasflker
lmeasdafrvhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmam
nitprlytdrsrdf

SCOPe Domain Coordinates for d1i50b_:

Click to download the PDB-style file with coordinates for d1i50b_.
(The format of our PDB-style files is described here.)

Timeline for d1i50b_: