Lineage for d1i50b_ (1i50 B:)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 619101Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 619102Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 619103Family e.29.1.1: RNA-polymerase beta [64485] (2 proteins)
  6. 619104Protein RBP2 [64491] (1 species)
  7. 619105Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64492] (9 PDB entries)
  8. 619107Domain d1i50b_: 1i50 B: [61755]
    Other proteins in same PDB: d1i50a_, d1i50c1, d1i50c2, d1i50e1, d1i50e2, d1i50f_, d1i50h_, d1i50i1, d1i50i2, d1i50j_, d1i50k_, d1i50l_
    complexed with mn, zn

Details for d1i50b_

PDB Entry: 1i50 (more details), 2.8 Å

PDB Description: rna polymerase ii crystal form ii at 2.8 a resolution
PDB Compounds: (B:)

SCOP Domain Sequences for d1i50b_:

Sequence, based on SEQRES records: (download)

>d1i50b_ e.29.1.1 (B:) RBP2 {Baker's yeast (Saccharomyces cerevisiae)}
fedesapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqh
ttesdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrty
eaidvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpf
dmggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvk
lygregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpc
vedgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkaff
lgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtve
eahdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrr
tntpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitf
lsewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmir
direkelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedve
eytwssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhatt
fthceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanily
ypqkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffr
symdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttp
ispdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqig
dkfasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaal
sgnegdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrh
mvddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasda
frvhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprly
tdrsrdf

Sequence, based on observed residues (ATOM records): (download)

>d1i50b_ e.29.1.1 (B:) RBP2 {Baker's yeast (Saccharomyces cerevisiae)}
fedesapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlieisfgki
yvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyekvfigrlpimlrskncy
lseatesdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaei
rsalekgsrfistlqvklygregssartikatlpyikqdipiviifralgiipdgeileh
icydvndwqmlemlkpcvedgfviqdretaldfigrrgtalgikkekriqyakdilqkef
lphitqlegfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktl
fkkltkdifrymqrtvelainaktitsglkyalatgnwgagvsqvlnrytysstlshlrr
tntpiakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgm
epledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdireke
lkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglvey
idaeeeesiliamqpedlepdvdpakrirvshhattfthceihpsmilgvaasiipfpdh
nqsprntyqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelpagq
naivaiacysgynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekpqrtn
tlrmkhgtydkldddgliapgvrvsgedviigkttpisskrdastplrstengivdqvlv
ttnqdglkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdliinp
haipsrmtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfevmyn
ghtgkklmaqiffgptyyqrlrhmvddkiharargpglrfgemerdcmiahgaasflker
lmeasdafrvhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmam
nitprlytdrsrdf

SCOP Domain Coordinates for d1i50b_:

Click to download the PDB-style file with coordinates for d1i50b_.
(The format of our PDB-style files is described here.)

Timeline for d1i50b_: