Lineage for d1i4yh_ (1i4y H:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535478Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 535562Superfamily a.24.4: Hemerythrin [47188] (1 family) (S)
  5. 535563Family a.24.4.1: Hemerythrin [47189] (2 proteins)
    Iron-binding proteins
  6. 535564Protein Hemerythrin [47190] (2 species)
  7. 535565Species Phascolopsis gouldii [TaxId:6442] [47192] (3 PDB entries)
  8. 535573Domain d1i4yh_: 1i4y H: [61745]
    complexed with cl, feo

Details for d1i4yh_

PDB Entry: 1i4y (more details), 1.8 Å

PDB Description: the crystal structure of phascolopsis gouldii wild type methemerythrin

SCOP Domain Sequences for d1i4yh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4yh_ a.24.4.1 (H:) Hemerythrin {Phascolopsis gouldii}
gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
lmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki

SCOP Domain Coordinates for d1i4yh_:

Click to download the PDB-style file with coordinates for d1i4yh_.
(The format of our PDB-style files is described here.)

Timeline for d1i4yh_: