Lineage for d1i4yd_ (1i4y D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699908Superfamily a.24.4: Hemerythrin-like [47188] (1 family) (S)
  5. 2699909Family a.24.4.1: Hemerythrin-like [47189] (2 proteins)
    Iron-binding proteins
  6. 2699910Protein Hemerythrin [47190] (2 species)
  7. 2699911Species Phascolopsis gouldii [TaxId:6442] [47192] (3 PDB entries)
  8. 2699915Domain d1i4yd_: 1i4y D: [61741]
    complexed with cl, feo

Details for d1i4yd_

PDB Entry: 1i4y (more details), 1.8 Å

PDB Description: the crystal structure of phascolopsis gouldii wild type methemerythrin
PDB Compounds: (D:) methemerythrin

SCOPe Domain Sequences for d1i4yd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4yd_ a.24.4.1 (D:) Hemerythrin {Phascolopsis gouldii [TaxId: 6442]}
gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
lmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki

SCOPe Domain Coordinates for d1i4yd_:

Click to download the PDB-style file with coordinates for d1i4yd_.
(The format of our PDB-style files is described here.)

Timeline for d1i4yd_: