Lineage for d1i4xa2 (1i4x A:121-239)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) 
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins) 
Protein Staphylococcal enterotoxin C2, SEC2 [54338] (1 species) Species Staphylococcus aureus [TaxId:1280] [54339] (7 PDB entries) 
Domain d1i4xa2: 1i4x A:121-239 [61737]
Other proteins in same PDB: d1i4xa1
Details for d1i4xa2
PDB Entry: 1i4x (more details), 2.4 Å
PDB Description: staphylococcal enterotoxin c2, monoclinic form crystallized at ph 8.0
SCOP Domain Sequences for d1i4xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4xa2 d.15.6.1 (A:121-239) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
SCOP Domain Coordinates for d1i4xa2:
Click to download the PDB-style file with coordinates for d1i4xa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i4xa2:
- d1i4xa2 is new in SCOP 1.57
- d1i4xa2 appears in SCOP 1.59
- d1i4xa2 appears in the current release, SCOPe 2.08
View in 3D
