![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.87: LexA/Signal peptidase [51305] (1 superfamily) complex fold made of several coiled beta-sheets; contains an SH3-like barrel |
![]() | Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families) ![]() |
![]() | Family b.87.1.1: LexA-related [51307] (4 proteins) |
![]() | Protein UmuD' [51308] (1 species) self-processed fragment of UmuD SOS response protein |
![]() | Species Escherichia coli [TaxId:562] [51309] (3 PDB entries) |
![]() | Domain d1i4vb_: 1i4v B: [61735] |
PDB Entry: 1i4v (more details)
SCOPe Domain Sequences for d1i4vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4vb_ b.87.1.1 (B:) UmuD' {Escherichia coli [TaxId: 562]} afpspaadyveqridlnqlliqhpsatyfvkasgdsmidggisdgdllivdsaitashgd iviaavdgeftvkklqlrptvqlipmnsayspitissedtldvfgvvihvvkamr
Timeline for d1i4vb_: