SCOPe 2.08: Domain d1i4va_: 1i4v A:

Lineage for d1i4va_ (1i4v A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
   complex fold made of several coiled beta-sheets; contains an SH3-like barrel

4. Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families)

5. Family b.87.1.1: LexA-related [51307] (4 proteins)

6. Protein UmuD' [51308] (1 species)
   self-processed fragment of UmuD SOS response protein

7. Species Escherichia coli [TaxId:562] [51309] (3 PDB entries)

8. Domain d1i4va_: 1i4v A: [61734]

Details for d1i4va_

PDB Entry: 1i4v

PDB Description: solution structure of the umud' homodimer

PDB Compounds: (A:) umud' protein

SCOPe Domain Sequences for d1i4va_:

Sequence; same for both SEQRES and ATOM records:

>d1i4va_ b.87.1.1 (A:) UmuD' {Escherichia coli [TaxId: 562]}
afpspaadyveqridlnqlliqhpsatyfvkasgdsmidggisdgdllivdsaitashgd
iviaavdgeftvkklqlrptvqlipmnsayspitissedtldvfgvvihvvkamr

Timeline for d1i4va_:

• d1i4va_ first appeared in SCOP 1.57
  
• d1i4va_ appears in SCOPe 2.07