Lineage for d1i4td_ (1i4t D:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) 
Family c.37.1.8: G proteins [52592] (20 proteins) 
Protein Rac [52595] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52596] (10 PDB entries) 
Domain d1i4td_: 1i4t D: [61731]
Other proteins in same PDB: d1i4ta_, d1i4tb_
Details for d1i4td_
PDB Entry: 1i4t (more details), 2.6 Å
PDB Description: crystal structure analysis of rac1-gmppnp in complex with arfaptin
SCOP Domain Sequences for d1i4td_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4td_ c.37.1.8 (D:) Rac {Human (Homo sapiens)}
qaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagl
edydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd
dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc
SCOP Domain Coordinates for d1i4td_:
Click to download the PDB-style file with coordinates for d1i4td_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i4td_:
- d1i4td_ is new in SCOP 1.57
- d1i4td_ appears in SCOP 1.59
- d1i4td_ appears in the current release, SCOPe 2.08
View in 3D
