Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) |
Family c.37.1.8: G proteins [52592] (20 proteins) |
Protein Rac [52595] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52596] (10 PDB entries) |
Domain d1i4td_: 1i4t D: [61731] Other proteins in same PDB: d1i4ta_, d1i4tb_ |
PDB Entry: 1i4t (more details), 2.6 Å
SCOP Domain Sequences for d1i4td_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4td_ c.37.1.8 (D:) Rac {Human (Homo sapiens)} qaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagl edydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc
Timeline for d1i4td_: