Lineage for d1i4ta_ (1i4t A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780741Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 780742Superfamily a.238.1: BAR/IMD domain-like [103657] (4 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 780763Family a.238.1.2: Arfaptin, Rac-binding fragment [64599] (1 protein)
  6. 780764Protein Arfaptin, Rac-binding fragment [64600] (1 species)
    active form is a dimer
  7. 780765Species Human (Homo sapiens) [TaxId:9606] [64601] (4 PDB entries)
  8. 780768Domain d1i4ta_: 1i4t A: [61729]
    Other proteins in same PDB: d1i4td_

Details for d1i4ta_

PDB Entry: 1i4t (more details), 2.6 Å

PDB Description: crystal structure analysis of rac1-gmppnp in complex with arfaptin
PDB Compounds: (A:) arfaptin 2

SCOP Domain Sequences for d1i4ta_:

Sequence, based on SEQRES records: (download)

>d1i4ta_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]}
srtvdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspel
qeefgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleyday
rtdleelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkql
llfhnavsayfagnq

Sequence, based on observed residues (ATOM records): (download)

>d1i4ta_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]}
srtvdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspel
qeefgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleyday
rtdleelslgprdagrdkyeklrgdvaiklkfleenkikvmhkqlllfhnavsayfagnq

SCOP Domain Coordinates for d1i4ta_:

Click to download the PDB-style file with coordinates for d1i4ta_.
(The format of our PDB-style files is described here.)

Timeline for d1i4ta_: