SCOP 1.63: Domain d1i4qa1: 1i4q A:1-120

Lineage for d1i4qa1 (1i4q A:1-120)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)

6. Protein Staphylococcal enterotoxin C2, SEC2 [50222] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50223] (7 PDB entries)

8. Domain d1i4qa1: 1i4q A:1-120 [61725]
   Other proteins in same PDB: d1i4qa2
   complexed with zn

Details for d1i4qa1

PDB Entry: 1i4q, 2.2 Å

PDB Description: crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 6.0

SCOP Domain Sequences for d1i4qa1:

Sequence, based on SEQRES records:

>d1i4qa1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg

Sequence, based on observed residues (ATOM records):

>d1i4qa1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnggktcmyggitkheg

Timeline for d1i4qa1:

• d1i4qa1 first appeared in SCOP 1.57
  
• d1i4qa1 appears in SCOP 1.61
  
• d1i4qa1 appears in SCOP 1.65
  
• d1i4qa1 appears in the current release, SCOPe 2.08