Lineage for d1i4qa1 (1i4q A:1-120)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166278Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 166605Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 166635Protein Staphylococcal enterotoxin C2, SEC2 [50222] (1 species)
  7. 166636Species Staphylococcus aureus [TaxId:1280] [50223] (7 PDB entries)
  8. 166641Domain d1i4qa1: 1i4q A:1-120 [61725]
    Other proteins in same PDB: d1i4qa2

Details for d1i4qa1

PDB Entry: 1i4q (more details), 2.2 Å

PDB Description: crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 6.0

SCOP Domain Sequences for d1i4qa1:

Sequence, based on SEQRES records: (download)

>d1i4qa1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg

Sequence, based on observed residues (ATOM records): (download)

>d1i4qa1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnggktcmyggitkheg

SCOP Domain Coordinates for d1i4qa1:

Click to download the PDB-style file with coordinates for d1i4qa1.
(The format of our PDB-style files is described here.)

Timeline for d1i4qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i4qa2