SCOP 1.63: Domain d1i4ld_: 1i4l D:

Lineage for d1i4ld_ (1i4l D:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (31 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rac [52595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52596] (10 PDB entries)

8. Domain d1i4ld_: 1i4l D: [61720]
   Other proteins in same PDB: d1i4la_, d1i4lb_
   rac1 in complex with arfaptin
   complexed with gdp, mg

Details for d1i4ld_

PDB Entry: 1i4l, 2.7 Å

PDB Description: crystal structure analysis of rac1-gdp in complex with arfaptin (p41)

SCOP Domain Sequences for d1i4ld_:

Sequence; same for both SEQRES and ATOM records:

>d1i4ld_ c.37.1.8 (D:) Rac {Human (Homo sapiens)}
qaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagq
edydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd
dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc

Timeline for d1i4ld_:

• d1i4ld_ first appeared in SCOP 1.57
  
• d1i4ld_ appears in SCOP 1.61
  
• d1i4ld_ appears in SCOP 1.65
  
• d1i4ld_ appears in the current release, SCOPe 2.08