Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) |
Family c.37.1.8: G proteins [52592] (26 proteins) |
Protein Rac [52595] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52596] (10 PDB entries) |
Domain d1i4ld_: 1i4l D: [61720] Other proteins in same PDB: d1i4la_, d1i4lb_ |
PDB Entry: 1i4l (more details), 2.7 Å
SCOP Domain Sequences for d1i4ld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4ld_ c.37.1.8 (D:) Rac {Human (Homo sapiens)} qaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagq edydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc
Timeline for d1i4ld_: