Lineage for d1i4ld_ (1i4l D:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121912Family c.37.1.8: G proteins [52592] (23 proteins)
  6. 122077Protein Rac [52595] (1 species)
  7. 122078Species Human (Homo sapiens) [TaxId:9606] [52596] (10 PDB entries)
  8. 122091Domain d1i4ld_: 1i4l D: [61720]
    Other proteins in same PDB: d1i4la_, d1i4lb_

Details for d1i4ld_

PDB Entry: 1i4l (more details), 2.7 Å

PDB Description: crystal structure analysis of rac1-gdp in complex with arfaptin (p41)

SCOP Domain Sequences for d1i4ld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4ld_ c.37.1.8 (D:) Rac {Human (Homo sapiens)}
qaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagq
edydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd
dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc

SCOP Domain Coordinates for d1i4ld_:

Click to download the PDB-style file with coordinates for d1i4ld_.
(The format of our PDB-style files is described here.)

Timeline for d1i4ld_: