Lineage for d1i4lb_ (1i4l B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2350990Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2350991Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2351020Family a.238.1.2: Arfaptin, Rac-binding fragment [64599] (2 proteins)
    automatically mapped to Pfam PF06456
  6. 2351021Protein Arfaptin, Rac-binding fragment [64600] (1 species)
    active form is a dimer
  7. 2351022Species Human (Homo sapiens) [TaxId:9606] [64601] (4 PDB entries)
  8. 2351026Domain d1i4lb_: 1i4l B: [61719]
    Other proteins in same PDB: d1i4ld_
    complexed with gdp, mg

Details for d1i4lb_

PDB Entry: 1i4l (more details), 2.7 Å

PDB Description: crystal structure analysis of rac1-gdp in complex with arfaptin (p41)
PDB Compounds: (B:) arfaptin 2

SCOPe Domain Sequences for d1i4lb_:

Sequence, based on SEQRES records: (download)

>d1i4lb_ a.238.1.2 (B:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]}
dlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspelqeef
gynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleydayrtdl
eelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkqlllfh
navsayfagnqkqleqt

Sequence, based on observed residues (ATOM records): (download)

>d1i4lb_ a.238.1.2 (B:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]}
dlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspelqeef
gynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleydayrtdl
eelslgprdkyeklrgdvaiklkfleenkikvmhkqlllfhnavsayfagnqkqleqt

SCOPe Domain Coordinates for d1i4lb_:

Click to download the PDB-style file with coordinates for d1i4lb_.
(The format of our PDB-style files is described here.)

Timeline for d1i4lb_: