Lineage for d1i4lb_ (1i4l B:)

  1. Root: SCOP 1.63
  2. 271841Class h: Coiled coil proteins [57942] (6 folds)
  3. 272641Fold h.4: Antiparallel coiled-coil [58086] (13 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 272688Superfamily h.4.7: Arfaptin, Rac-binding fragment [64598] (1 family) (S)
  5. 272689Family h.4.7.1: Arfaptin, Rac-binding fragment [64599] (1 protein)
  6. 272690Protein Arfaptin, Rac-binding fragment [64600] (1 species)
    active form is a dimer
  7. 272691Species Human (Homo sapiens) [TaxId:9606] [64601] (4 PDB entries)
  8. 272699Domain d1i4lb_: 1i4l B: [61719]
    Other proteins in same PDB: d1i4ld_
    complexed with gdp, mg

Details for d1i4lb_

PDB Entry: 1i4l (more details), 2.7 Å

PDB Description: crystal structure analysis of rac1-gdp in complex with arfaptin (p41)

SCOP Domain Sequences for d1i4lb_:

Sequence, based on SEQRES records: (download)

>d1i4lb_ h.4.7.1 (B:) Arfaptin, Rac-binding fragment {Human (Homo sapiens)}
dlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspelqeef
gynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleydayrtdl
eelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkqlllfh
navsayfagnqkqleqt

Sequence, based on observed residues (ATOM records): (download)

>d1i4lb_ h.4.7.1 (B:) Arfaptin, Rac-binding fragment {Human (Homo sapiens)}
dlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspelqeef
gynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleydayrtdl
eelslgprdkyeklrgdvaiklkfleenkikvmhkqlllfhnavsayfagnqkqleqt

SCOP Domain Coordinates for d1i4lb_:

Click to download the PDB-style file with coordinates for d1i4lb_.
(The format of our PDB-style files is described here.)

Timeline for d1i4lb_: