Class b: All beta proteins [48724] (178 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
Protein Archaeal homoheptameric Sm protein [63758] (6 species) |
Species Archaeoglobus fulgidus, AF-Sm1 [TaxId:2234] [63761] (2 PDB entries) |
Domain d1i4km_: 1i4k M: [61704] complexed with cit |
PDB Entry: 1i4k (more details), 2.5 Å
SCOPe Domain Sequences for d1i4km_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4km_ b.38.1.1 (M:) Archaeal homoheptameric Sm protein {Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} pprpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvv irgdtvvfvspa
Timeline for d1i4km_:
View in 3D Domains from other chains: (mouse over for more information) d1i4k1_, d1i4k2_, d1i4ka_, d1i4kb_, d1i4kc_, d1i4kd_, d1i4ke_, d1i4kf_, d1i4kg_, d1i4kh_, d1i4ki_, d1i4kj_, d1i4kk_, d1i4kl_, d1i4kn_, d1i4ko_, d1i4kp_, d1i4kq_, d1i4kr_, d1i4ks_, d1i4kt_, d1i4ku_, d1i4kv_, d1i4kw_, d1i4kx_, d1i4ky_, d1i4kz_ |